Specification
| Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P23700 |
| Gene Names | omcB |
| Alternative Names | Large-CRP Alternative name(s): 60KDA cysteine-rich OMP Short name: 60KDA CRP 60KDA outer membrane protein Cysteine-rich outer membrane protein |
| Expression Region | Partial(41-196aa ) |
| Molecular Weight | 33.3 kDa |
| Protein Sequence | SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Periplasm |
| Protein Families | |
| Tissue Specificity | omcB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |