Specification
| Organism | Chikungunya virus (strain S27-African prototype) (CHIKV) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8JUX6 |
| Gene Names | nsp4 |
| Alternative Names | Polyprotein nsP1234 |
| Expression Region | Partial(2228-2474aa ) |
| Molecular Weight | 31.1 kDa |
| Protein Sequence | DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Non-structural polyprotein: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Note=Located on the cytoplasmic surface of modified endosomes and lysosomes, also called cytopathic vacuoles type I (CPVI), These vacuoles contain numerous small circular invaginations (spherules) which may be the sites of RNA synthesis, SUBCELLULAR LOCATION: P123: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: mRNA-capping enzyme nsP1: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then a fraction of nsP1 localizes to the inner surface of the plasma membrane and its filopodial extensions (By similarity), SUBCELLULAR LOCATION: Protease nsP2: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host nucleus, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then approximately half of nsP2 is found in the nucleus (By similarity), SUBCELLULAR LOCATION: Non-structural protein 3: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cytoplasm |
| Protein Families | |
| Tissue Specificity | nsp4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |