Recombinant Chicken Vesicle-associated membrane protein 7(VAMP7),partial

Specification
Organism Gallus gallus (Chicken)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q5ZL74
Gene Names VAMP7
Alternative Names Synaptobrevin-like protein 1
Expression Region Cytoplasmic Domain(2-181aa )
Molecular Weight 24.3 kDa
Protein Sequence AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIIYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKYHSESKGTDQVAETQAQVDELKGIMVRNIDLVAQRGEKLELLIDKTENLVDSSVTFKTTSRNLARA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the targeting and/or fusion of transport vesicles to their target mbrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for focal exocytosis of late endocytic vesicles during phagosome formation .
Involvement in Disease
Subcellular Location Cytoplasmic vesicle, secretory vesicle membrane, Single-pass type IV membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type IV membrane protein, Late endosome membrane, Single-pass type IV membrane protein, Lysosome membrane, Single-pass type IV membrane protein, Endoplasmic reticulum membrane, Single-pass type IV membrane protein, Cytoplasmic vesicle, phagosome membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome
Protein Families Synaptobrevin family
Tissue Specificity VAMP7
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE5CH25910

Recombinant Chicken Vesicle-associated membrane protein 7(VAMP7),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Chicken Vesicle-associated membrane protein 7(VAMP7),partial
Copyright © 2026-present Echo Bio. All rights reserved.