Specification
| Organism | Gallus gallus (Chicken) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P09531 |
| Gene Names | TGFB1 |
| Alternative Names | TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor beta-1; TGF-beta-1)] |
| Expression Region | Partial(260-373aa ) |
| Molecular Weight | 29 kDa |
| Protein Sequence | DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of th have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone rodeling. It is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts . |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | TGFB1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
