Recombinant Chicken Homeobox protein engrailed-1(EN1)

Specification
Organism Gallus gallus (Chicken)
Expression Host E.coli
Tag Info N-terminal 6xHis-B2M-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q05916
Gene Names EN1
Alternative Names Short name:Gg-En-1 Short name:Homeobox protein en-1
Expression Region Full Length(1-333aa )
Molecular Weight 48.5 kDa
Protein Sequence MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Nucleus
Protein Families Engrailed homeobox family
Tissue Specificity EN1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE9CH7784

Recombinant Chicken Homeobox protein engrailed-1(EN1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Chicken Homeobox protein engrailed-1(EN1)
Copyright © 2021-present Echo Biosystems. All rights reserved.