Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1(RHOT1),partial

Specification
Organism Gallus gallus (Chicken)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q5ZM73
Gene Names RHOT1
Alternative Names MIRO-1 Alternative name(s): Ras homolog gene family member T1
Expression Region Partial(1-219aa )
Molecular Weight 41 kDa
Protein Sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).
Involvement in Disease
Subcellular Location Mitochondrion outer membrane, Single-pass type IV membrane protein
Protein Families Mitochondrial Rho GTPase family
Tissue Specificity RHOT1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE6CH720161

Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1(RHOT1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1(RHOT1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.