Specification
| Organism | Centruroides noxius (Mexican scorpion) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P01495 |
| Gene Names | N/A |
| Alternative Names | Toxin II.9.2.2 |
| Expression Region | Full Length of Mature Protein(17-82aa ) |
| Molecular Weight | 9.6 kDa |
| Protein Sequence | KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |