Specification
| Organism | Cenarchaeum symbiosum (strain A) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A0RYM0 |
| Gene Names | polC |
| Alternative Names | polC; CENSYa_1827DNA polymerase II large subunit; Pol II; EC 2.7.7.7; Exodeoxyribonuclease large subunit; EC 3.1.11.1 |
| Expression Region | Partial(287-832aa ) |
| Molecular Weight | 59 kDa |
| Protein Sequence | LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Archaeal DNA polymerase II family |
| Tissue Specificity | polC |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |