Recombinant Cat Serum amyloid A protein(SAA1),partial

Specification
Organism Felis catus (Cat) (Felis silvestris catus)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P19707
Gene Names SAA1
Alternative Names Amyloid fibril protein AACurated
Expression Region Partial(1-90aa )
Molecular Weight 12.1 kDa
Protein Sequence EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in Disease Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Subcellular Location Secreted
Protein Families SAA family
Tissue Specificity SAA1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PY6CA20781

Recombinant Cat Serum amyloid A protein(SAA1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Cat Serum amyloid A protein(SAA1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.