Recombinant Carcinus maenas Crustacean hyperglycemic hormones,partial

Specification
Organism Carcinus maenas (Common shore crab) (Green crab)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P14944
Gene Names N/A
Alternative Names Crustacean hyperglycemic hormones [Cleaved into: CHH precursor-related peptide; CPRP); Crustacean hyperglycemic hormone; CHH)]
Expression Region Partial(67-138aa )
Molecular Weight 16.0 kDa
Protein Sequence QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PECDS318745

Recombinant Carcinus maenas Crustacean hyperglycemic hormones,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Carcinus maenas Crustacean hyperglycemic hormones,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.