Specification
| Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q6FXR8 |
| Gene Names | ATG8 |
| Alternative Names | Autophagy-related ubiquitin-like modifier ATG8 |
| Expression Region | Full Length(1-116aa ) |
| Molecular Weight | 29.5 kDa |
| Protein Sequence | MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Participates also in mbrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent mbranes and stimulates mbrane hifusion, leading to expansion of the autophagosomal mbrane during autophagy . |
| Involvement in Disease | |
| Subcellular Location | Cytoplasmic vesicle, autophagosome membrane, Lipid-anchor, Vacuole membrane, Lipid-anchor |
| Protein Families | ATG8 family |
| Tissue Specificity | ATG8 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |