Specification
| Organism | Candida albicans (strain WO-1) (Yeast) |
| Expression Host | Yeast |
| Tag Info | C-terminal 6xHis-Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | C4YMJ3 |
| Gene Names | SAP2 |
| Alternative Names | ACP 2 Aspartate protease 2 Secreted aspartic protease 2 |
| Expression Region | Full Length of Mature Protein(57-398aa ) |
| Molecular Weight | 40.1 kDa |
| Protein Sequence | QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDNNEISLAQVKYTSASSISALT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Miscellaneous Expressed both in W (white) and in O (opaque) cells of strain WO-1. Catalytic activity Preferential cleavage at the carboxyl of hydrophobic amino acids, but fails to cleave 15-Leu-|-Tyr-16, 16-Tyr-|-Leu-17 and 24-Phe-|-Phe-25 of insulin B chain. Activates trypsinogen, and degrades keratin. EC:3.4.23.24 |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | SAP2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
