Specification
| Organism | Caenorhabditis elegans |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P32740 |
| Gene Names | R107.2 |
| Alternative Names | ATP-dependent NAD(P)HX dehydratase |
| Expression Region | Full Length(1-307aa ) |
| Molecular Weight | 35.9 kDa |
| Protein Sequence | MDHFIKLLPKLTPHLRKGDCGKMGVIGGSLEYTGAPYFAASSASRLGADLIHIFCDPDAAQVIKGYSPDLIVHPGMTANSIIPKLSRMDAIVIGPGLGRNPNIWPLMQELFEFVRNRDVPFVIDGDGLWFVSEHIEKFPRQMSATVLTPNIVEFSRLCKSALGEEDVLNVRNNSQLQHLAAELSRKMNVTIYLKGEVDLVVTPNGEVSKCSTESSLRRCGGQGDVTAGSLGLFLYWAKKNLGDDWTSAHHEAGIASSWLVRTAGRRAFEKHGRSMNTPLLLDEIPKLVRDVETREMKDTVHTDSSKH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | NnrD/CARKD family |
| Tissue Specificity | R107.2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |