Specification
| Organism | Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q01499 |
| Gene Names | N/A |
| Alternative Names | Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20); Capsid protein C; E(rns) glycoprotein; gp44/48); Envelope glycoprotein E1; gp33); Envelope glycoprotein E2; gp55); p7; Non-structural protein 2-3; Cysteine protease NS2; EC 3.4.22.-; Non-structural protein 2); Serine protease NS3; EC 3.4.21.113; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 3); Non-structural protein 4A; NS4A); Non-structural protein 4B; NS4B); Non-structural protein 5A; NS5A); RNA-directed RNA polymerase; EC 2.7.7.48; NS5B)] |
| Expression Region | Partial(1-168aa ) |
| Molecular Weight | 20.4 |
| Protein Sequence | MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |