Specification
Organism | Bos taurus (Bovine) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P35541 |
Gene Names | SAA1 |
Alternative Names | Amyloid fibril protein AA (SAA) |
Expression Region | Full Length of Mature Protein(19-130aa ) |
Molecular Weight | 30.1 kDa |
Protein Sequence | QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Major acute phase reactant. Apolipoprotein of the HDL complex. |
Involvement in Disease | Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. |
Subcellular Location | Secreted |
Protein Families | SAA family |
Tissue Specificity | SAA1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |