Recombinant Bovine Serpin A3-2(SERPINA3-2)

Specification
Organism Bos taurus (Bovine)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A2I7M9
Gene Names SERPINA3-2
Alternative Names SERPINA3-2; Serpin A3-2
Expression Region Full Length of Mature Protein(25-411aa )
Molecular Weight 45.6 kDa
Protein Sequence LPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGVAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Serine protease inhibitor.
Involvement in Disease
Subcellular Location Cytoplasmic vesicle, secretory vesicle, chromaffin granule, Secreted
Protein Families Serpin family
Tissue Specificity SERPINA3-2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PY5BO382220

Recombinant Bovine Serpin A3-2(SERPINA3-2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bovine Serpin A3-2(SERPINA3-2)
Copyright © 2021-present Echo Biosystems. All rights reserved.