Recombinant Bovine Odorant-binding protein

Specification
Organism Bos taurus (Bovine)
Expression Host Yeast
Tag Info N-terminal 6xHis-sumostar-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P07435
Gene Names N/A
Alternative Names Olfactory mucosa pyrazine-binding protein
Expression Region Full Length(1-159aa )
Molecular Weight 34.5 kDa
Protein Sequence AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This protein binds a wide variety of chemical odorants.
Involvement in Disease
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYOa43621459

Recombinant Bovine Odorant-binding protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bovine Odorant-binding protein
Copyright © 2021-present Echo Biosystems. All rights reserved.