Specification
| Organism | BO-Bos taurus (Bovine) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-KSI-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q6E804 |
| Gene Names | NOD2 |
| Alternative Names | Caspase recruitment domain-containing protein 15 |
| Expression Region | Partial(1-191aa ) |
| Molecular Weight | 36.8 kDa |
| Protein Sequence | MCAQDAFQTQRSQLVELLVSGSLEGFESILDRLLSREVLSWEDYEGLSLVGQPISHLARRLLDTIWNKGTWGCEQLTAAVREAQADSQPPELPSSWDPHSPHPARDLQSHRPAIVRRLYGHVEGVLDLTQQRGFISQYETDEIRRPIFTSSQRARRLLDLATVKANGLAAFLLQCIQELPVPLALPFEDAA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in gastrointestinal immunity. Upon stimulation by muramyl dipeptide (MDP), a fragment of bacterial peptidoglycan, binds the proximal adapter receptor-interacting RIPK2, which recruits ubiquitin ligases as XIAP, BIRC2, BIRC3, INAVA and the LUBAC complex, triggering activation of MAP kinases and activation of NF-kappa-B signaling. This in turn leads to the transcriptional activation of hundreds of genes involved in immune response. Required for MDP-induced NLRP1-dependent CASP1 activation and IL1B release in macrophages. Component of an autophagy-mediated antibacterial pathway together with ATG16L1. Plays also a role in sensing single-stranded RNA (ssRNA) from viruses. Interacts with mitochondrial antiviral signaling/MAVS, leading to activation of interferon regulatory factor-3/IRF3 and expression of type I interferon. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | NOD2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |