Specification
| Organism | Bos taurus (Bovine) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | |
| Biological Activity | |
| Uniprot ID | Q9BE40 |
| Gene Names | MYH1 |
| Alternative Names | (Myosin heavy chain 1)(Myosin heavy chain 2x)(MyHC-2x)(Myosin heavy chain, skeletal muscle, adult 1) |
| Expression Region | 585-794aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1645 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1767℃. |
| Protein Length | Partial |
| Molecular Weight | 30.9 kDa |
| Protein Sequence | YAGTVDYNITGWLDKNKDPLNETVVGLYQKSSVKTLALLFSGPASGEAEGGPKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDVDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQLITRTQAR |
Background
| Research Areas | Others |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |