Specification
| Organism | Bos taurus (Bovine) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P43480 |
| Gene Names | IL10 |
| Alternative Names | Cytokine synthesis inhibitory factor ;CSIF |
| Expression Region | Full Length of Mature Protein(19-178aa ) |
| Molecular Weight | 20.6 kDa |
| Protein Sequence | SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-10 family |
| Tissue Specificity | IL10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |