Recombinant Bovine Fibronectin(FN1),partial

Specification
Organism Bos taurus (Bovine)
Expression Host E.coli
Protein Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P07589
Gene Names FN1
Alternative Names (FN)
Expression Region 53-273aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.382 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-496℃.
Protein Length Partial
Molecular Weight 32.4 kDa
Protein Sequence CYDNGKHYQINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCER
Background
Research Areas Cancer
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$378.00
In stock
SKU
EB-N231417

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bovine Fibronectin(FN1),partial
Copyright © 2026-present Echo Bio. All rights reserved.