Recombinant Bovine Cation-independent mannose-6-phosphate receptor(IGF2R),partial

Specification
Organism Bos taurus (Bovine)
Expression Host Mammalian cell
Protein Tag Tag-Free
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P08169
Gene Names IGF2R
Alternative Names (CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannose 6-phosphate receptor)(MPR 300)(Insulin-like growth factor 2 receptor)(Insulin-like growth factor II receptor)(IGF-II receptor)(CD antigen CD222)
Expression Region 628-772aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.937 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1051℃.
Protein Length Partial
Molecular Weight 18.4 kDa
Protein Sequence LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Background
Research Areas Immunology
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$805.00
In stock
SKU
EB-N231972

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bovine Cation-independent mannose-6-phosphate receptor(IGF2R),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.