Specification
Organism | Bos taurus (Bovine) |
Expression Host | E.coli |
Protein Tag | N-terminal 6xHis-tagged |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | P08169 |
Gene Names | IGF2R |
Alternative Names | (CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannose 6-phosphate receptor)(MPR 300)(Insulin-like growth factor 2 receptor)(Insulin-like growth factor II receptor)(IGF-II receptor)(CD antigen CD222) |
Expression Region | 628-772aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.753 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-867℃. |
Protein Length | Partial |
Molecular Weight | 22.4 kDa |
Protein Sequence | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Background
Research Areas | Immunology |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |