Specification
| Organism | Bos taurus (Bovine) |
| Expression Host | Baculovirus |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q29414 |
| Gene Names | ASIP |
| Alternative Names | Agouti switch protein (ASP) |
| Expression Region | Full Length of Mature Protein(23-133aa ) |
| Molecular Weight | 14.9 |
| Protein Sequence | HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis and thus increasing synthesis of pheomelanin . |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | ASIP |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |