Specification
| Organism | Bos taurus (Bovine) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P00257 |
| Gene Names | FDX1 |
| Alternative Names | Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX) |
| Expression Region | Full Length of Mature Protein(59-186aa ) |
| Molecular Weight | 19.5 kDa |
| Protein Sequence | SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion matrix |
| Protein Families | Adrenodoxin/putidaredoxin family |
| Tissue Specificity | FDX1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |