Specification
| Organism | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P17835 |
| Gene Names | fim3 |
| Alternative Names | fim3; BP1568; Serotype 3 fimbrial subunit |
| Expression Region | Full Length of Mature Protein(26-204aa ) |
| Molecular Weight | 23.2 kDa |
| Protein Sequence | NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process. |
| Involvement in Disease | |
| Subcellular Location | Fimbrium |
| Protein Families | Fimbrial protein family |
| Tissue Specificity | fim3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
