Recombinant Bordetella pertussis Serotype 3 fimbrial subunit(fim3)

Specification
Organism Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P17835
Gene Names fim3
Alternative Names fim3; BP1568; Serotype 3 fimbrial subunit
Expression Region Full Length of Mature Protein(26-204aa )
Molecular Weight 23.2 kDa
Protein Sequence NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.
Involvement in Disease
Subcellular Location Fimbrium
Protein Families Fimbrial protein family
Tissue Specificity fim3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEAa03229835

Recombinant Bordetella pertussis Serotype 3 fimbrial subunit(fim3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bordetella pertussis Serotype 3 fimbrial subunit(fim3)
Copyright © 2021-present Echo Biosystems. All rights reserved.