Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial

Specification
Organism Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P14283
Gene Names prn
Alternative Names P.93
Expression Region Partial(632-910aa )
Molecular Weight 45.8 kDa
Protein Sequence ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.
Involvement in Disease
Subcellular Location Pertactin autotransporter: Periplasm, SUBCELLULAR LOCATION: Outer membrane protein P69: Secreted, Cell surface, SUBCELLULAR LOCATION: Pertactin translocator: Cell outer membrane, Multi-pass membrane protein
Protein Families
Tissue Specificity prn
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEBUA321349

Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.