Specification
| Organism | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P14283 |
| Gene Names | prn |
| Alternative Names | P.93 |
| Expression Region | Partial(632-910aa ) |
| Molecular Weight | 45.8 kDa |
| Protein Sequence | ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough. |
| Involvement in Disease | |
| Subcellular Location | Pertactin autotransporter: Periplasm, SUBCELLULAR LOCATION: Outer membrane protein P69: Secreted, Cell surface, SUBCELLULAR LOCATION: Pertactin translocator: Cell outer membrane, Multi-pass membrane protein |
| Protein Families | |
| Tissue Specificity | prn |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |