Specification
| Organism | Bombyx mori (Silk moth) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P17219 |
| Gene Names | N/A |
| Alternative Names | ; Prothoracicotropic hormone; PTTH) [Cleaved into: P2K; P6K; Prothoracicotropic hormone] |
| Expression Region | Full Length of Mature Protein(116-224aa ) |
| Molecular Weight | 16.7 kDa |
| Protein Sequence | GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |