Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)

Specification
Organism Blomia tropicalis (Mite)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O96870
Gene Names BLOT5
Alternative Names Allergen: Blo t 5
Expression Region Full Length(1-134aa )
Molecular Weight 31.6 kDa
Protein Sequence MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families Mite group 5 allergen family
Tissue Specificity BLOT5
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEBTN527405

Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)
Copyright © 2026-present Echo Bio. All rights reserved.