Specification
Organism | Betula pendula (European white birch) (Betula verrucosa) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P25816 |
Gene Names | BETVII |
Alternative Names | Allergen Bet v II Pollen allergen Bet v 2 Allergen: Bet v 2 |
Expression Region | Full Length of Mature Protein(2-133aa ) |
Molecular Weight | 30.1 kDa |
Protein Sequence | SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. |
Involvement in Disease | |
Subcellular Location | Cytoplasm, cytoskeleton |
Protein Families | Profilin family |
Tissue Specificity | BETVII |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |