Specification
| Organism | Betula pendula (European white birch) (Betula verrucosa) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P15494 |
| Gene Names | BETVIA |
| Alternative Names | Allergen Bet v I-A Allergen: Bet v 1-A |
| Expression Region | Full Length of Mature Protein(2-160aa ) |
| Molecular Weight | 33.4 kDa |
| Protein Sequence | GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be a general steroid carrier protein. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | BetVI family |
| Tissue Specificity | BETVIA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |