Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI(BuXI)

Specification
Organism Bauhinia ungulata (Orchid tree)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P83594
Gene Names BuXI
Alternative Names Factor Xa inhibitor BuXI
Expression Region Full Length(1-172aa )
Molecular Weight 21.2 kDa
Protein Sequence DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa.
Involvement in Disease
Subcellular Location Secreted
Protein Families Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family
Tissue Specificity BuXI
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYBFM307235

Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI(BuXI)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI(BuXI)
Copyright © 2021-present Echo Biosystems. All rights reserved.