Specification
| Organism | Bacillus thuringiensis subsp. Morrisoni |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O66377 |
| Gene Names | cry1Fb |
| Alternative Names | 132 kDa crystal protein Crystaline entomocidal protoxin Insecticidal delta-endotoxin CryIF(b) cryIF(b), cryINA67-1 |
| Expression Region | Partial(984-1169aa ) |
| Molecular Weight | 26.3 kDa |
| Protein Sequence | VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Delta endotoxin family |
| Tissue Specificity | cry1Fb |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |