Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac(cry1Ac),partial

Specification
Organism Bacillus thuringiensis subsp. kurstaki
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P05068
Gene Names cry1Ac
Alternative Names 133KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(c)
Expression Region Partial(972-1178aa )
Molecular Weight 25.8 kDa
Protein Sequence LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Involvement in Disease
Subcellular Location
Protein Families Delta endotoxin family
Tissue Specificity cry1Ac
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYBDC356573

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac(cry1Ac),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac(cry1Ac),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.