Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry2Aa(cry2Aa),partial

Specification
Organism Bacillus thuringiensis subsp. Kurstaki
Expression Host E.coli
Protein Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P0A377
Gene Names cry2Aa
Alternative Names (71 kDa crystal protein)(Crystaline entomocidal protoxin)(Insecticidal delta-endotoxin CryIIA(a))(Mosquito factor)(P2 crystal protein)
Expression Region 267-472aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.24 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-116℃.
Protein Length Partial
Molecular Weight 29.7 kDa
Protein Sequence LMVSSGANLYASGSGPQQTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGVSSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLSLRCGAFSARGNSNYFPDYFIRNISGVPLVIRNEDLTRPLHYNQIRNIESPSGTPGGARAYLVSVHNRKN
Background
Research Areas Others
Relevance Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae.
Function
Reference "Two highly related insecticidal crystal proteins of Bacillus thuringiensis subsp. kurstaki possess different host range specificities." Widner W.R., Whiteley H.R. J. Bacteriol. 171:965-974(1989)
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$378.00
In stock
SKU
EB-N231037

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry2Aa(cry2Aa),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.