Specification
| Organism | Bacillus thuringiensis subsp. Kurstaki |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P0A377 |
| Gene Names | cry2Aa |
| Alternative Names | (71 kDa crystal protein)(Crystaline entomocidal protoxin)(Insecticidal delta-endotoxin CryIIA(a))(Mosquito factor)(P2 crystal protein) |
| Expression Region | 267-472aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.24 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-116℃. |
| Protein Length | Partial |
| Molecular Weight | 29.7 kDa |
| Protein Sequence | LMVSSGANLYASGSGPQQTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGVSSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLSLRCGAFSARGNSNYFPDYFIRNISGVPLVIRNEDLTRPLHYNQIRNIESPSGTPGGARAYLVSVHNRKN |
Background
| Research Areas | Others |
| Relevance | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of both dipteran (Aedes aegypti) and lepidopteran (Manduca sexta) larvae. |
| Function | |
| Reference | "Two highly related insecticidal crystal proteins of Bacillus thuringiensis subsp. kurstaki possess different host range specificities." Widner W.R., Whiteley H.R. J. Bacteriol. 171:965-974(1989) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |