Specification
| Organism | Bacillus thuringiensis |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q45739 |
| Gene Names | cry1Bb |
| Alternative Names | (140 kDa crystal protein)(Crystaline entomocidal protoxin)(Insecticidal delta-endotoxin CryIB(b)) |
| Expression Region | 1111-1229aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.25 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-117℃. |
| Protein Length | Partial |
| Molecular Weight | 21.1 kDa |
| Protein Sequence | NCEEEEVYPTDTGTCNDYTAHQGTAACNSRNAGYEDAYEVDTTASVNYKPTYEEETYTDVRRDNHCEYDRGYVNYPPVPAGYVTKELEYFPETDTVWIEIGETEGKFIVDSVELLLMEE |
Background
| Research Areas | Others |
| Relevance | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
| Function | |
| Reference | "Bacillus thuringiensis cryet4 and cryet5 toxin genes and proteins toxic to lepidopteran insects." Donovan W.P., Tan Y., Jany C.S., Gonzalez J.M. Jr. Patent number US5322687, 21-JUN-1994 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |