Recombinant Bacillus subtilis Subtilosin-A(sboA)

Specification
Organism Bacillus subtilis (strain 168)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID O07623
Gene Names sboA
Alternative Names Antilisterial bacteriocin subtilosin (sbo)
Expression Region Full Length of Mature Protein(9-43aa )
Molecular Weight 3.4 kDa
Protein Sequence NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood
Involvement in Disease
Subcellular Location Secreted
Protein Families Bacteriocin class V family
Tissue Specificity sboA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$499.00
In stock
SKU
EB-PEBRJ522609

Recombinant Bacillus subtilis Subtilosin-A(sboA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bacillus subtilis Subtilosin-A(sboA)
Copyright © 2021-present Echo Biosystems. All rights reserved.