Specification
| Organism | Bacillus subtilis (strain 168) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O07623 |
| Gene Names | sboA |
| Alternative Names | Antilisterial bacteriocin subtilosin (sbo) |
| Expression Region | Full Length of Mature Protein(9-43aa ) |
| Molecular Weight | 3.4 kDa |
| Protein Sequence | NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Bacteriocin class V family |
| Tissue Specificity | sboA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |