Specification
| Organism | Bacillus subtilis (strain 168) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P40750 |
| Gene Names | pbpD |
| Alternative Names | pbpD; BSU31490; Penicillin-binding protein 4; PBP 4) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)] |
| Expression Region | Partial(213-450aa ) |
| Molecular Weight | 43 kDa |
| Protein Sequence | PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Peripheral membrane protein |
| Protein Families | Glycosyltransferase 51 family; Transpeptidase family |
| Tissue Specificity | pbpD |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |