Specification
| Organism | Bacillus subtilis (strain 168) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P42199 |
| Gene Names | tcyA |
| Alternative Names | tcyA; yckK; BSU03610; L-cystine-binding protein TcyA |
| Expression Region | Full Length of Mature Protein(20-268aa ) |
| Molecular Weight | 43.6 kDa |
| Protein Sequence | CGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Part of the ABC transporter complex TcyABC involved in L-cystine import. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Lipid-anchor |
| Protein Families | Bacterial solute-binding protein 3 family |
| Tissue Specificity | tcyA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |