Specification
| Organism | Bacillus pumilus (strain SAFR-032) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A8FG14 |
| Gene Names | zapA |
| Alternative Names | Z ring-associated protein ZapA |
| Expression Region | Full Length(1-85aa ) |
| Molecular Weight | 25.9 kDa |
| Protein Sequence | MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | ZapA family, Type 2 subfamily |
| Tissue Specificity | zapA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |