Specification
Organism | Bacillus megaterium (strain ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / VKM B-512) |
Expression Host | E.coli |
Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | P14779 |
Gene Names | cyp102A1 |
Alternative Names | (Cytochrome P450(BM-3))(Cytochrome P450BM-3)(Fatty acid monooxygenase)(Flavocytochrome P450 BM3)(Cytochrome P450 102A1)(NADPH--cytochrome P450 reductase) |
Expression Region | 2-472aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.104 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-196℃. |
Protein Length | Partial |
Molecular Weight | 61.2 kDa |
Protein Sequence | TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVR |
Background
Research Areas | Cancer |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |