Specification
| Organism | Bacillus licheniformis |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P00780 |
| Gene Names | apr |
| Alternative Names | subC; apr; Subtilisin Carlsberg; EC 3.4.21.62 |
| Expression Region | Full Length of Mature protein(106-379aa ) |
| Molecular Weight | 42.0 kDa |
| Protein Sequence | AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Peptidase S8 family |
| Tissue Specificity | apr |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |