Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)

Specification
Organism Bacillus licheniformis
Expression Host E.coli
Tag Info N-terminal 10xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P00780
Gene Names apr
Alternative Names subC; apr; Subtilisin Carlsberg; EC 3.4.21.62
Expression Region Full Length of Mature protein(106-379aa )
Molecular Weight 42.0 kDa
Protein Sequence AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Involvement in Disease
Subcellular Location Secreted
Protein Families Peptidase S8 family
Tissue Specificity apr
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEBQT365595

Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bacillus licheniformis Subtilisin Carlsberg(apr)
Copyright © 2021-present Echo Biosystems. All rights reserved.