Recombinant Bacillus licheniformis N-acetylmuramoyl-L-alanine amidase CwlM(cwlM)

Specification
Organism Bacillus licheniformis
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P37134
Gene Names cwlM
Alternative Names Autolysin;Cell wall hydrolase
Expression Region Full Length(1-253aa )
Molecular Weight 43.6 kDa
Protein Sequence MVKIFIDPGHGGSDTGASANGLQEKQLTLQTALALRNMLLNEYQNVSVLLSRTSDQTVSLTQRTNAANSWGADYFLSIHMNAGGGTGFEDYIYPGVGAPTTTYRDIMHEEILKVVDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKSSAFIQSIARGHANGLARAFNLSKNAAALYKVQIAAFRTKANADSLAAQAEAKGFDALVIYRDSLYKVQIGAFSSKENAEALVQQAKNAEFDTFIYQE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Hydrolyzes the cell wall of M.luteus more efficiently than that of B.licheniformis and B.subtilis. The C-terminal region, including the repeats, determines substrate specificity.
Involvement in Disease
Subcellular Location Secreted
Protein Families N-acetylmuramoyl-L-alanine amidase 3 family
Tissue Specificity cwlM
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEBQT339905

Recombinant Bacillus licheniformis N-acetylmuramoyl-L-alanine amidase CwlM(cwlM)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Bacillus licheniformis N-acetylmuramoyl-L-alanine amidase CwlM(cwlM)
Copyright © 2021-present Echo Biosystems. All rights reserved.