Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab(rep),partial

Specification
Organism Avian infectious bronchitis virus (strain KB8523) (IBV)
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P12723
Gene Names rep
Alternative Names pp1ab;ORF1ab polyprotein
Expression Region Partial(1-219aa )
Molecular Weight 26.9 kDa
Protein Sequence GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. NendoU is a Mn2+-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity rep
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMARV318405

Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab(rep),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab(rep),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.