Recombinant Avian infectious bronchitis virus Nucleoprotein(N)

Specification
Organism Avian infectious bronchitis virus (strain KB8523) (IBV)
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P12648
Gene Names N
Alternative Names Nucleocapsid protein;NC;Protein N
Expression Region Full Length(1-409aa )
Molecular Weight 47.2 kDa
Protein Sequence MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNSPPLKFEGSGVPDNENLKTSQQHGYWRRQARFKPSKGGRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGKSTAASSAASSRAPSREGSRGRRSGAEDDLIARAAKIIQDQQKKGARITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVSRNDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRTSSPAPRQPRPKKEKKTKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMARV320260

Recombinant Avian infectious bronchitis virus Nucleoprotein(N)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Avian infectious bronchitis virus Nucleoprotein(N)
Copyright © 2021-present Echo Biosystems. All rights reserved.