Specification
| Organism | Avian infectious bronchitis virus (strain Gray) (IBV) |
| Expression Host | E.coli |
| Protein Tag | C-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P32923 |
| Gene Names | N |
| Alternative Names | (Nucleocapsid protein)(NC)(Protein N) |
| Expression Region | 1-409aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.14 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-106℃. |
| Protein Length | Full Length |
| Molecular Weight | 47.7 kDa |
| Protein Sequence | MASGKATGKTDAPAPVIKLGGPRPPKVGSSGNASWFQAIKAKKLNSPQPKFEGSGVPDNENFKTSQQHGYWRRQARFKPGKGRRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADVKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRPPSREGSRGRRSGSEDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRTSSPAPRQQRLKKEKRPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL |
Background
| Research Areas | Microbiology |
| Relevance | Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. |
| Function | |
| Reference | "Comparative analyses of the nucleocapsid genes of several strains of infectious bronchitis virus and other coronaviruses." Williams A.K., Wang L., Sneed L.W., Collisson E.W. Virus Res. 25:213-222(1992) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |