Specification
| Uniprot ID | P32923 |
| Gene Names | N |
| Alternative Names | (Nucleocapsid protein)(NC)(Protein N) |
| Organism | Avian infectious bronchitis virus (strain Gray) (IBV) |
| Expression Host | E.coli |
| Tag Info | C-terminal 6xHis-tagged |
| Molecular Weight | 47.7 kDa |
| Expression Region | Full Length(1-409aa ) |
| Expression Region | C-terminal 6xHis-tagged(Full Length ) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Not test. |
| Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | MASGKATGKTDAPAPVIKLGGPRPPKVGSSGNASWFQAIKAKKLNSPQPKFEGSGVPDNENFKTSQQHGYWRRQARFKPGKGRRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADVKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRPPSREGSRGRRSGSEDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRTSSPAPRQQRLKKEKRPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL |
Background
| Research Areas | Microbiology |
| Relevance | Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |