Specification
| Organism | Avian infectious bronchitis virus (strain Portugal/322/82) (IBV) |
| Expression Host | E.coli |
| Protein Tag | C-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P30242 |
| Gene Names | 3b |
| Alternative Names | (ns3b)(Accessory protein 3b) |
| Expression Region | 1-64aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.6 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-98℃. |
| Protein Length | Full Length |
| Molecular Weight | 8.7 kDa |
| Protein Sequence | MLDFAAIIETGQQIIQQISFNLQHISSVLSTELFDPFEVCVYRGGNYWELESADDCSGDDEFIE |
Background
| Research Areas | Others |
| Relevance | |
| Function | |
| Reference | "A polycistronic mRNA specified by the coronavirus infectious bronchitis virus." Liu D.X., Cavanagh D., Green P., Inglis S.C. Virology 184:531-544(1991) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |