Specification
| Organism | Autographa californica nuclear polyhedrosis virus (AcMNPV) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25783 |
| Gene Names | VCATH |
| Alternative Names | Cysteine proteinase Short name: CP |
| Expression Region | Full Length of Mature Protein(113-323aa ) |
| Molecular Weight | 39.9 kDa |
| Protein Sequence | PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Host endoplasmic reticulum |
| Protein Families | Peptidase C1 family |
| Tissue Specificity | VCATH |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |