Specification
Organism | Aspergillus kawachii (strain NBRC 4308) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-sumostar-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q96WQ9 |
Gene Names | eglD |
Alternative Names | Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A |
Expression Region | Full Length of Mature Protein(21-408aa ) |
Molecular Weight | 55.7 kDa |
Protein Sequence | HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | Glycosyl hydrolase 61 family |
Tissue Specificity | eglD |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |